DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and AT2G04930

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_178570.1 Gene:AT2G04930 / 815040 AraportID:AT2G04930 Length:277 Species:Arabidopsis thaliana


Alignment Length:283 Identity:70/283 - (24%)
Similarity:126/283 - (44%) Gaps:83/283 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 CIHTTVIKDMCADCGADLRQNE--------NG-QTSEASVPMVHTMPDLKVTQKLAQKLGHDDTR 200
            |.|..|.:.:|..|.:.:.:::        .| |.|..:|.:         |:.|..|      .
plant    10 CGHWYVFQGICIGCKSKVHKSQFRKFDYIFKGLQLSNEAVAL---------TKSLTTK------H 59

  Fly   201 RLLADRKLVLLVDLDQTVIHTTNDTVPDNI----------------KGIYHFQLYGPHSPWYHTR 249
            ..|.::||.|::|||.|::|:   .:..|:                :.::.|:..| |......:
plant    60 SCLNEKKLHLVLDLDHTLLHS---KLVSNLSQAERYLIQEASSRTREDLWKFRPIG-HPIDRLIK 120

  Fly   250 LRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDECFNATSKTDNLKA 314
            |||...:||:..::::.:.:.|.|:|.||..|.:::||:..:|.:|::::||  :...||.||..
plant   121 LRPFVRDFLKEANEMFTMFVYTMGSRIYAKAILEMIDPKKLYFGNRVITKDE--SPRMKTLNLVL 183

  Fly   315 LFPNGDSMVCIIDDREDVW-NMASNLIQVKPYHFFQHTGDINAPPGLSKHELDGEGVDFKEITEK 378
            ....|   |.|:||..|:| :..:||||::.|.:|:.:|            ||            
plant   184 AEERG---VVIVDDTRDIWPHHKNNLIQIRKYKYFRRSG------------LD------------ 221

  Fly   379 HGDKDKTESSSEVKPEDTDKGDN 401
                  :.|.||.|   ||:|:|
plant   222 ------SNSYSEKK---TDEGEN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 46/162 (28%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
AT2G04930NP_178570.1 FCP1_euk 61..215 CDD:131304 46/162 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2939
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683531at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2696
orthoMCL 1 0.900 - - OOG6_102037
Panther 1 1.100 - - O PTHR23081
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.