DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and ublcp1

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_021324596.1 Gene:ublcp1 / 792145 ZFINID:ZDB-GENE-040718-3 Length:371 Species:Danio rerio


Alignment Length:325 Identity:64/325 - (19%)
Similarity:112/325 - (34%) Gaps:129/325 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 KQIEIEDPDDYLL-----------YLEVILRNIHKRF------------YSI--YDETTEIPDLK 580
            |.:....||.::|           |:.|:|.:.....            |||  ..|...:.|||
Zfish    18 KYVRYVAPDPFVLCIDHQWTSTVAYVGVVLPSSSTSMSVSVIIKWGGQEYSINTLSEEDTVLDLK 82

  Fly   581 VIVPKIRSEVLRGKNLVFSGLVPTQMKLEQSRAYFIAKSLGAEV--KPNIDKEITHLVAVNAGTY 643
            ..:..:            :|::|.:.||           ||.::  ||..|            ..
Zfish    83 QSIKSL------------TGVLPERQKL-----------LGLKLKGKPADD------------NV 112

  Fly   644 KVNAAKKEPAIKVVNANWLWTCAERWEHVEEKLFPLDRKVRNKGRQPPAHCHSPEHVVN-YSERS 707
            |:...|.:|..|::      ....|.|.:|:.|.|           ||.:    :.||| :....
Zfish   113 KLGDLKLKPNTKIM------MMGTREESLEDVLAP-----------PPEN----DDVVNDFDIEE 156

  Fly   708 EISPSSSKQQE-----EQSGNFR-ETLNP------LLVFTNADIESMNKDYETFFESDSSSDEGP 760
            |::...::::.     .:..::: |.|||      |||.   ||     || |.|:..|.::.| 
Zfish   157 EVTEVENREENLAKIARRVKDYKVEELNPPRPGKRLLVL---DI-----DY-TLFDHKSCAETG- 211

  Fly   761 VNFENPPMDKKLLKRKREDDNSNRAHDFFTRS----DDIMIGAPNLVEVDISSNE--EADDNNEK 819
                     .:|::        ...|:|.|.:    |.::..|.::..:|....|  ..|:.|.|
Zfish   212 ---------HELMR--------PFLHEFLTSAYEDFDIVIWSATSMKWIDAKMKELGVTDNPNYK 259

  Fly   820  819
            Zfish   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304
COG5275 481..>658 CDD:227600 27/143 (19%)
BRCT 587..665 CDD:278934 13/79 (16%)
ublcp1XP_021324596.1 UBQ 59..130 CDD:320785 20/111 (18%)
HAD_IIID1 170..364 CDD:131299 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.