DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and Timm50

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_079892.1 Gene:Timm50 / 66525 MGIID:1913775 Length:353 Species:Mus musculus


Alignment Length:150 Identity:33/150 - (22%)
Similarity:66/150 - (44%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DLDQTVIHTTND-TVPDNIKGIYH-------FQLYGP--HSPW-----YHTRLRPGTAEFLERMS 262
            |..|.:|..|:. .:||.::..|:       .:|.|.  |..|     :..:.|||.....::::
Mouse   121 DYRQMIIEPTSPCLLPDPLREPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLA 185

  Fly   263 QLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDECFNATSKTDNLKALFPNGD-SMVCII 326
            .|||:.|.|......|..:...:||.| |.|:|:......:.......::..|  |.| :.|.::
Mouse   186 PLYEIVIFTSETGMTAFPLIDSVDPHG-FISYRLFRDATRYMEGHHVKDISCL--NRDPARVVVV 247

  Fly   327 DDREDVWNMAS-NLIQVKPY 345
            |.:::.:.:.. |.:.::|:
Mouse   248 DCKKEAFRLQPFNGVALRPW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 33/149 (22%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
Timm50NP_079892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..59
NIF 148..295 CDD:281081 26/122 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.