DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and AT3G19595

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001118664.1 Gene:AT3G19595 / 6241385 AraportID:AT3G19595 Length:307 Species:Arabidopsis thaliana


Alignment Length:330 Identity:76/330 - (23%)
Similarity:142/330 - (43%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KRLRKEGELLTKGDAILELSECIHTTVIKDMCADCGADLRQNENG---------QTSEASVPMVH 179
            ||.:.|..:.....::...|.|.|..:...:|..|.:.:::::..         |.|..:|.:..
plant    14 KRRKIEPTINESSSSLSSSSSCGHWYICHGICIGCKSTVKKSQGRAFDYIFDGLQLSHEAVALTK 78

  Fly   180 TMPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHTTNDTVP----------------- 227
            ..     |.||:          .|.::||.|::|||.|::||.  .||                 
plant    79 CF-----TTKLS----------CLNEKKLHLVLDLDHTLLHTV--MVPSLSQAEKYLIEEAGSAT 126

  Fly   228 -DNIKGIYHFQLYGPHSPW-YHTRLRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGK 290
             |::     :::.....|. :.|:|||...:||:..::.:.:::.|.|:|.||..:.:|:||:..
plant   127 RDDL-----WKIKAVGDPMEFLTKLRPFLRDFLKEANEFFTMYVYTKGSRVYAKQVLELIDPKKL 186

  Fly   291 FFSHRILSRDECFNATSKTDNLKAL-FPNGDSM-VCIIDDREDVW-NMASNLIQVKPYHFFQHTG 352
            :|..|::::.|       :.::|.| |...:.. |.|:||..:|| :..|||:.:..|.:|:..|
plant   187 YFGDRVITKTE-------SPHMKTLDFVLAEERGVVIVDDTRNVWPDHKSNLVDISKYSYFRLKG 244

  Fly   353 DINAPPGLSK-HELDGEG---VDFKEITEKHGDKDKTESSSEVKPEDTDKGDNTVTSTSKDDDVN 413
            ..:.|....| .|.:.||   ...|.:.|.|....:.|       |:.:..|........|.::|
plant   245 QDSMPYSEEKTDESESEGGLANVLKLLKEVHQRFFRVE-------EELESKDVRSLLQEIDFELN 302

  Fly   414 EESVD 418
            .|||:
plant   303 VESVE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706 3/17 (18%)
FCP1_euk 202..348 CDD:131304 44/167 (26%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
AT3G19595NP_001118664.1 FCP1_euk 86..240 CDD:131304 44/167 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2939
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683531at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2696
orthoMCL 1 0.900 - - OOG6_102037
Panther 1 1.100 - - O PTHR23081
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.