DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and CTDSP1

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_016860104.1 Gene:CTDSP1 / 58190 HGNCID:21614 Length:409 Species:Homo sapiens


Alignment Length:262 Identity:68/262 - (25%)
Similarity:109/262 - (41%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LFLYQPVGVDAKDA--KDAGKPGGDCAIQ---RYKSQRAGVVKKRLRKEGELLTKGDAILELSEC 145
            :|.:.|.|....||  :.|....|..|.:   |:|..:.....::.|..|        ||....|
Human   121 VFSFSPCGPQDLDAAPRSAHPRLGLAAPELRARWKGDQKSAASQKPRSRG--------ILHSLFC 177

  Fly   146 IHTTVIKD----MCADCGADLRQNENGQTSEASVPMVHTMPDLKVTQKLAQKLGHDDTRRLLADR 206
               .|.:|    :.|..||.|...|||...: ..|:.:.:|:.|...                ..
Human   178 ---CVCRDDGEALPAHSGAPLLVEENGAIPK-QTPVQYLLPEAKAQD----------------SD 222

  Fly   207 KLVLLVDLDQTVIHTT----NDT---VPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQL 264
            |:.:::|||:|::|::    |:.   :|..|.|:.| |:|        ...||...|||:||.:|
Human   223 KICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVH-QVY--------VLKRPHVDEFLQRMGEL 278

  Fly   265 YELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKALFPNGDSM--VCII 326
            :|..:.|.....||..:|.|||..|.|.:.  |.|:.| |:..:...:|..|   |..:  |.|:
Human   279 FECVLFTASLAKYADPVADLLDKWGAFRAR--LFRESCVFHRGNYVKDLSRL---GRDLRRVLIL 338

  Fly   327 DD 328
            |:
Human   339 DN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706 14/60 (23%)
FCP1_euk 202..348 CDD:131304 41/137 (30%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
CTDSP1XP_016860104.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.