DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and Ctdsp2

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001106941.1 Gene:Ctdsp2 / 52468 MGIID:1098748 Length:270 Species:Mus musculus


Alignment Length:219 Identity:51/219 - (23%)
Similarity:87/219 - (39%) Gaps:62/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 QRAGVVKKRLRKEGELLTKGDAILELSE--------------CIHTTVIKDMCADCGADLRQNEN 167
            :...::.:..|::..:|||...:.:.|.              |.||..:  :.:....:|...|.
Mouse     2 EHGSIITQARREDALVLTKQGLVSKSSPKKPRGRSIFKALLCCFHTQHV--VQSSSSTELTHKEE 64

  Fly   168 GQTSEAS------------VPMVHTMPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIH 220
            ..|...|            :|....:|:  ||:   |..|           ::.:::|||:|::|
Mouse    65 ANTIAKSDLLQCLQYQFYQIPGTCLLPE--VTE---QDQG-----------RICVVIDLDETLVH 113

  Fly   221 TT----NDT---VPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYA 278
            ::    |:.   ||..|:|..| |:|        ...||...|||.||.:|:|..:.|.....||
Mouse   114 SSFKPINNADFIVPVEIEGTTH-QVY--------VLKRPYVDEFLRRMGELFECVLFTASLAKYA 169

  Fly   279 HMIAQLLDPEGKFFSHRILSRDEC 302
            ..:..|||..|.|.:.  |.|:.|
Mouse   170 DPVTDLLDRCGVFRAR--LFREAC 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706 4/24 (17%)
FCP1_euk 202..348 CDD:131304 33/108 (31%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
Ctdsp2NP_001106941.1 HIF-SF_euk 100..259 CDD:274055 33/103 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.