DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and ctdnep1b

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001007441.2 Gene:ctdnep1b / 492799 ZFINID:ZDB-GENE-041114-152 Length:248 Species:Danio rerio


Alignment Length:175 Identity:48/175 - (27%)
Similarity:76/175 - (43%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 RLLADRKLVLLVDLDQTVIHTTND----------TVPDNIKGIYHFQLYGPHSPWYHTRLRPGTA 255
            ||...::.:|::|||:|:||:.:|          |.||.|..:    :...|...:....||...
Zfish    59 RLNNVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKV----VIDKHPVRFFVHKRPHVD 119

  Fly   256 EFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKALFPNG 319
            .|||.:||.|||.:.|.....|...:|..|| ..|....|...|..| .::.|...:|..:..:.
Zfish   120 FFLEVVSQWYELVVFTASMEIYGSAVADKLD-NNKAILKRRYYRQHCTLDSGSYIKDLSVVHDDL 183

  Fly   320 DSMVCIIDDREDVW-NMASNLIQVKPYHFFQHTGD---INAPPGL 360
            .|:| |:|:....: :...|.|.:|.:  |....|   :|..|.|
Zfish   184 SSVV-ILDNSPGAYRSHPDNAIPIKSW--FSDPSDTALLNLLPML 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 42/157 (27%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
ctdnep1bNP_001007441.2 HIF-SF_euk 65..233 CDD:274055 46/169 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.