Sequence 1: | NP_001286846.1 | Gene: | Fcp1 / 37925 | FlyBaseID: | FBgn0035026 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006793.1 | Gene: | ctdsp2 / 448497 | XenbaseID: | XB-GENE-951111 | Length: | 271 | Species: | Xenopus tropicalis |
Alignment Length: | 202 | Identity: | 52/202 - (25%) |
---|---|---|---|
Similarity: | 78/202 - (38%) | Gaps: | 61/202 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 CAIQRYKSQRAGVVKKRLRKEGELLT-KGDAILELSECIHTTVIKDMCADCGADLRQNENGQTSE 172
Fly 173 ASVPMVHTMPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHTT-------NDTVPDNI 230
Fly 231 KGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHR 295
Fly 296 ILSRDEC 302 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fcp1 | NP_001286846.1 | Biotinyl_lipoyl_domains | 59..142 | CDD:299706 | 9/33 (27%) |
FCP1_euk | 202..348 | CDD:131304 | 37/108 (34%) | ||
COG5275 | 481..>658 | CDD:227600 | |||
BRCT | 587..665 | CDD:278934 | |||
ctdsp2 | NP_001006793.1 | HIF-SF_euk | 101..260 | CDD:274055 | 37/103 (36%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |