DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and ctdsp2

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001006793.1 Gene:ctdsp2 / 448497 XenbaseID:XB-GENE-951111 Length:271 Species:Xenopus tropicalis


Alignment Length:202 Identity:52/202 - (25%)
Similarity:78/202 - (38%) Gaps:61/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CAIQRYKSQRAGVVKKRLRKEGELLT-KGDAILELSECIHTTVIKDMCADCGADLRQNENGQTSE 172
            |...:..|:.||.::..:.||....| |.|    |.:|:                      |...
 Frog    44 CLSAQNVSRPAGSIEPPIPKEETNATPKSD----LLQCL----------------------QYQF 82

  Fly   173 ASVPMVHTMPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHTT-------NDTVPDNI 230
            ..:|....:|::....|                .|:.:::|||:|::|::       :..||..|
 Frog    83 YQIPGTSLLPEVAPKDK----------------EKICMVIDLDETLVHSSFKPISNADFIVPVEI 131

  Fly   231 KGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHR 295
            :|..| |:|        ...||...||||||.||||..:.|.....||..:..|||..|.|.|. 
 Frog   132 EGTTH-QVY--------VLKRPYVDEFLERMGQLYECVLFTASLAKYADPVTDLLDKSGVFRSR- 186

  Fly   296 ILSRDEC 302
             |.|:.|
 Frog   187 -LFREAC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706 9/33 (27%)
FCP1_euk 202..348 CDD:131304 37/108 (34%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
ctdsp2NP_001006793.1 HIF-SF_euk 101..260 CDD:274055 37/103 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.