DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and timm50

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_956959.1 Gene:timm50 / 393638 ZFINID:ZDB-GENE-040426-1618 Length:387 Species:Danio rerio


Alignment Length:349 Identity:71/349 - (20%)
Similarity:122/349 - (34%) Gaps:109/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RVREGQFVSAA-QILFLYQPVGVDAKDAKDAGKPGGDCAIQRYKSQRAGVVKKRLRKEGELLTKG 136
            |:|:|...|.| .:|.:.:|:..|...:...|  |...||.:.:.|:....:::...|||     
Zfish    19 RLRQGARCSTAPPLLDVVRPLSADTSSSSATG--GLAQAILQERLQQQQKSQEQPPPEGE----- 76

  Fly   137 DAILELSECIHTTVIKDMCADCGADLRQNENGQTSEASVPMVHTMPDLKVTQKLAQKLGH---DD 198
            |:..:..|             .|.|.:|.||...::..|..:..:..|..|..:....|.   |:
Zfish    77 DSGHKQDE-------------QGEDKKQKENTAYAKKMVLRLAGIMGLGGTVGIVYIFGSNSVDE 128

  Fly   199 TRRLLAD-------------RKLVLLVDLDQTVIHTTN-DTVPDNIKGIYHFQLYGP-------- 241
            ....:.|             |......|..|.:|..|: ..:||.::..|    |.|        
Zfish   129 QGNKIPDEFDNDVPVIQQLRRTFKYFKDYRQMIIEPTSPKLLPDPLREPY----YQPPYTLVLEL 189

  Fly   242 -----HSPW-----YHTRLRPGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRI 296
                 |..|     :..:.|||.....::::.|||:.|.|......|:.:...:||:| |..:| 
Zfish   190 TDVLLHPEWSLATGWRFKKRPGIDYLFQQLAPLYEIVIFTSETGMTAYPLIDSIDPQG-FVMYR- 252

  Fly   297 LSRD-------------ECFNA-TSKTDNLKALFPNGDSMVCIIDDREDVWNMASNLIQVKPYHF 347
            |.||             .|.|. |||              |.::|.:.:.:.:       :|:: 
Zfish   253 LFRDATRYMEGHHVKDVSCLNRDTSK--------------VIVVDCKREAFGL-------QPFN- 295

  Fly   348 FQHTGDINAPPGLSKHELDGEGVD 371
                       ||:..:.||...|
Zfish   296 -----------GLALCKWDGNSED 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706 17/69 (25%)
FCP1_euk 202..348 CDD:131304 38/191 (20%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
timm50NP_956959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..93 9/49 (18%)
NIF 183..330 CDD:281081 32/161 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.