DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and ttm50

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster


Alignment Length:249 Identity:56/249 - (22%)
Similarity:91/249 - (36%) Gaps:75/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NGQTSE---ASVPMV-----HTMPDLKVTQKLAQ-----KLGHDDTRRLLADRKLVLLVDLDQTV 218
            |||..|   ...|:|     .....:...|::.|     ||..|..:......:..|::::...:
  Fly   175 NGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYTLVLEMKDVL 239

  Fly   219 IHTTNDTVPDNIKGIYHFQLYGPHSPW-YHT----RLRPGTAEFLERMSQLYELHICTFGARNYA 278
            :|      ||                | |.|    :.|||...||...::.:|:.:.|.......
  Fly   240 VH------PD----------------WTYQTGWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTV 282

  Fly   279 HMIAQLLDPEGKFFSHRILSRDECFNATSKTD-----NLKALFPNGDSMVCIIDDREDVWNMASN 338
            ..|...|||.| :..:|:: ||    ||...|     ||..|  |.|....|:.|    |:  :|
  Fly   283 FPILDALDPNG-YIMYRLV-RD----ATHFVDGHHVKNLDNL--NRDLKKVIVVD----WD--AN 333

  Fly   339 LIQVKPYHFFQHTGDINAPPGLSK-HELDGEG-----VDFKEITEKHGDKDKTE 386
            ..::.|.:.|          ||:: |..|.:|     :.|.:|..::...|..|
  Fly   334 ATKMHPDNTF----------GLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVRE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 35/155 (23%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 40/173 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.