DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and Ctdspl2

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_038960896.1 Gene:Ctdspl2 / 311368 RGDID:1309219 Length:478 Species:Rattus norvegicus


Alignment Length:164 Identity:48/164 - (29%)
Similarity:75/164 - (45%) Gaps:43/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LLVDLDQTVIH-TTND------TVPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQLYEL 267
            |::|||:|::| :.|:      |.|...:.:. :|:|        .||||...||||||||:||:
  Rat   302 LVLDLDETLVHCSLNELEDAALTFPVLFQDVI-YQVY--------VRLRPFFREFLERMSQMYEI 357

  Fly   268 HICTFGARNYAHMIAQLLDPEGKFFSHRILSRDECF--------------NATSKT---DNLKAL 315
            .:.|...:.||..:..:|||:.:...|| |.|:.|.              ...|||   ||....
  Rat   358 ILFTASKKVYADKLLNILDPKKQLVRHR-LFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQA 421

  Fly   316 F----PNGDSMVCIIDDREDVWNMASNLIQVKPY 345
            |    .||..:.....|:.|     :.|:::.|:
  Rat   422 FAYQLSNGIPIESWFMDKND-----NELLKLIPF 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 48/164 (29%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
Ctdspl2XP_038960896.1 HIF-SF_euk 299..460 CDD:274055 48/164 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.