Sequence 1: | NP_001286846.1 | Gene: | Fcp1 / 37925 | FlyBaseID: | FBgn0035026 | Length: | 880 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036020359.1 | Gene: | Ctdsp1 / 227292 | MGIID: | 2654470 | Length: | 302 | Species: | Mus musculus |
Alignment Length: | 269 | Identity: | 66/269 - (24%) |
---|---|---|---|
Similarity: | 107/269 - (39%) | Gaps: | 82/269 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 AGVVKKRLRKE---GELLTKGDAILELSE------CIHT---TVIKD----MCADCGADLRQNEN 167
Fly 168 GQTSEASVPMVHTMPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHTT----NDT--- 225
Fly 226 VPDNIKGIYHFQLYG-------------------------------PH--SPWYHTRLRPGTAEF 257
Fly 258 LERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKALFPNGDS 321
Fly 322 M--VCIIDD 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fcp1 | NP_001286846.1 | Biotinyl_lipoyl_domains | 59..142 | CDD:299706 | 8/25 (32%) |
FCP1_euk | 202..348 | CDD:131304 | 44/170 (26%) | ||
COG5275 | 481..>658 | CDD:227600 | |||
BRCT | 587..665 | CDD:278934 | |||
Ctdsp1 | XP_036020359.1 | HIF-SF_euk | 90..290 | CDD:274055 | 44/165 (27%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5190 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |