DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and W04A8.1

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_493420.1 Gene:W04A8.1 / 173252 WormBaseID:WBGene00012236 Length:667 Species:Caenorhabditis elegans


Alignment Length:509 Identity:94/509 - (18%)
Similarity:159/509 - (31%) Gaps:171/509 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 DDNSKESTKAEVPPTPAEKNEVVASSTTSPDEKRPSAD-ADVATTSKTPSLRAPLEGQKQIEIED 547
            ||..:.||......||.:...  .|:.|.....:.|.| :|:::.....|:.:.:......|.|.
 Worm    19 DDEHRHSTHFSSADTPKKTGR--PSNRTMGTSIQISGDFSDLSSFRPENSVISEIVLDSGDEEEV 81

  Fly   548 PDDYLLYLEVILRNIHKRFYSIYDETTEIPDLKVIVPKIRSEVLRGKNLVFSG--LVPTQMKLEQ 610
            ||.    .|.:|         ..|:..|:|:        ....|.|..:|.|.  .:|.:..|.:
 Worm    82 PDS----REDVL---------ACDDDEEVPE--------SVGYLAGTVIVLSAGCCLPIRHHLSK 125

  Fly   611 SRAYFIAKSLGAEVKPNIDKEITHLVAVNAGTYKV----NAAKKEPAIKVVNANWLWTCAER--- 668
            ...     .:|||::..||...||:|.......|:    .:.|.||.: :|:..|:..|.:.   
 Worm   126 KLI-----EMGAEIQKTIDNRTTHIVVDRYADEKLVGEAMSRKPEPPM-MVDVKWIQECLDNRQK 184

  Fly   669 -------------------------------------WEHVEE-------KLFPLDRKVRNK--- 686
                                                 ||.:|.       ||....||:..:   
 Worm   185 CKENDFSMIGLRYLKQSCRRLSSFREPTPLGDEEETFWEDMENDAPTDPAKLLEQIRKLSERLDA 249

  Fly   687 ------------------------GRQPPA-------------HCHSPEHVVNYSERSEISPSSS 714
                                    ..||||             ...|||.:....  :.||.||:
 Worm   250 LMDCKPHVPVIRFEYHSPDCPTRQQPQPPAPPAKKASQRPKNSRIPSPEALQQLF--TSISTSST 312

  Fly   715 KQQEEQSGNF----RETLNPLLVFTNADIESMNKDYETFFESDSSSDEGPVNFENPPMDKKLLKR 775
            .::......|    ||..|..|     :::..|.|..              |..||.:..|..::
 Worm   313 LRRRRSFTGFVLEHREPGNAAL-----EVQEANNDVR--------------NTWNPELGAKKPRK 358

  Fly   776 KRE-------DDNSNRAHDFFTRSDDIMIGAP-NLVEVDISSNEEADDNNEKE-------DDDDE 825
            .|:       |.....|.|..|..|.:...:. |.......|.:.|.::|.::       ||.|.
 Worm   359 TRKAPQKTVNDMRKTMAADLTTIRDVLAKNSDLNRARTPKKSKKPAKNSNSRQKMMPVHVDDSDI 423

  Fly   826 MPSAKFRRGEDLPSD----LELGSESN----SEKEPEDEDDGEWNMMGAALERE 871
            ..:.......:.|.:    :.:.:.||    .:|..|::||...:.:.|.|:|:
 Worm   424 QSALASLTISEAPRECSVQILVPTRSNVINQLQKRHEEDDDDFISDVSAFLQRK 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304
COG5275 481..>658 CDD:227600 39/180 (22%)
BRCT 587..665 CDD:278934 20/83 (24%)
W04A8.1NP_493420.1 BRCT 106..180 CDD:237994 20/79 (25%)
BRCT 493..558 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23081
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.