DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and UBLCP1

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_659486.2 Gene:UBLCP1 / 134510 HGNCID:28110 Length:318 Species:Homo sapiens


Alignment Length:270 Identity:56/270 - (20%)
Similarity:93/270 - (34%) Gaps:107/270 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 YSI--YDETTEIPDLKVIVPKIRSEVLRGKNLVFSGLVPTQMKLEQSRAYFIAKSLGAEVKPN-I 628
            ||:  ..|...:.|||..:..:            :|::|.:.||           ||.:||.. .
Human    14 YSVTTLSEDDTVLDLKQFLKTL------------TGVLPERQKL-----------LGLKVKGKPA 55

  Fly   629 DKEITHLVAVNAGTYKVNAAKKEPAIKVVNANWLWTCAERWEHVEEKLFPLDRKVRNKGRQPPAH 693
            :.::           |:.|.|.:|..|::      ....|.|.:|:.|.|           ||.:
Human    56 ENDV-----------KLGALKLKPNTKIM------MMGTREESLEDVLGP-----------PPDN 92

  Fly   694 ------CHSPEHVVNYSERSEISPSSSKQQEEQSGNFRETLNP------LLVFTNADIESMNKDY 746
                  ....:.||....|.|.....|::.:|..   .|.|||      |||        ::.||
Human    93 DDVVNDFDIEDEVVEVENREENLLKISRRVKEYK---VEILNPPREGKKLLV--------LDVDY 146

  Fly   747 ETFFESDSSSDEGPVNFENPPMDKKLLKRKREDDNSNRAHDFFTRS----DDIMIGAPN------ 801
             |.|:..|.::.| |....|.:                 |:|.|.:    |.::..|.|      
Human   147 -TLFDHRSCAETG-VELMRPYL-----------------HEFLTSAYEDYDIVIWSATNMKWIEA 192

  Fly   802 -LVEVDISSN 810
             :.|:.:|:|
Human   193 KMKELGVSTN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304
COG5275 481..>658 CDD:227600 19/93 (20%)
BRCT 587..665 CDD:278934 13/78 (17%)
UBLCP1NP_659486.2 Ubl_UBLCP1 3..77 CDD:340511 19/102 (19%)
HAD_IIID1 117..311 CDD:131299 26/116 (22%)
Phosphatase 133..294 20/97 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.