DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and ctdspl

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_031759361.1 Gene:ctdspl / 100487887 XenbaseID:XB-GENE-1013061 Length:276 Species:Xenopus tropicalis


Alignment Length:236 Identity:59/236 - (25%)
Similarity:92/236 - (38%) Gaps:80/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 ENGQTSEA---------SVPMVHTMPDLKVTQKLAQKLGHDDTRRLLADRKLVLLVDLDQTVIHT 221
            |||...:|         |.|..:.:|:|||:..                .|..:::|||:|::|:
 Frog    72 ENGGIQKADQTQALTIPSPPAKYLLPELKVSDY----------------GKKCVVIDLDETLVHS 120

  Fly   222 T----NDT---VPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYAH 279
            :    |:.   ||..|.|..| |:|        ...||...|||::|.:|:|..:.|.....||.
 Frog   121 SFKPINNADFIVPVEIDGTIH-QVY--------VLKRPHVDEFLQKMGELFECVLFTASLAKYAD 176

  Fly   280 MIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKALFPNGDSMVCI------------------ 325
            .:|.|||..|.|.:.  |.|:.| |:..:...:|..|......::.|                  
 Frog   177 PVADLLDRWGVFNAR--LFRESCVFHRGNYVKDLSRLGRELSKVIIIDNSPASYIFHPENAVPVQ 239

  Fly   326 --IDDREDVWNMASNLIQVKPYHFFQHTGDINAPPGLSKHE 364
              .||..|     :.|:.:.|  ||:         ||||.:
 Frog   240 SWFDDMTD-----TELLDLIP--FFE---------GLSKED 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 43/173 (25%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
ctdsplXP_031759361.1 HIF-SF_euk 106..264 CDD:274055 49/184 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.