| Sequence 1: | NP_611932.2 | Gene: | CG11414 / 37923 | FlyBaseID: | FBgn0035024 | Length: | 867 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_872063.2 | Gene: | lst-5 / 353399 | WormBaseID: | WBGene00016890 | Length: | 346 | Species: | Caenorhabditis elegans |
| Alignment Length: | 260 | Identity: | 55/260 - (21%) |
|---|---|---|---|
| Similarity: | 94/260 - (36%) | Gaps: | 76/260 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 99 DKLPYRE--------------LEANNRSDLYSKKYR--IGFCTAE--------------IRQQF- 132
Fly 133 -FKLLDHPCPKCDAPPYRTF---EGLRNHVRSEH---KLLY-------CDLCVETLNIFTFERRC 183
Fly 184 YTQAELQLHNTKGDPDNRSHRGHPLCEYCNKRYVDRDELFRHL---RREHYFCHFCDADGCNEFY 245
Fly 246 NDYADLAEHFRAEHFLCEEGKCATEQFVGAFRNEIEY-KAH-----VANVHGKS----LNKQQAK 300
Fly 301 300 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11414 | NP_611932.2 | COG5236 | 2..>294 | CDD:227561 | 52/252 (21%) |
| zf-C3HC4_3 | 44..94 | CDD:290631 | |||
| DUF4187 | <220..259 | CDD:290533 | 11/41 (27%) | ||
| lst-5 | NP_872063.2 | C2H2 Zn finger | 111..132 | CDD:275368 | 8/24 (33%) |
| C2H2 Zn finger | 147..168 | CDD:275368 | 4/24 (17%) | ||
| C2H2 Zn finger | 177..197 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 208..227 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 235..255 | CDD:275368 | 3/19 (16%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5236 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||