DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nurf-38 and PPa1

DIOPT Version :10

Sequence 1:NP_523849.3 Gene:Nurf-38 / 37922 FlyBaseID:FBgn0016687 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_171613.1 Gene:PPa1 / 839579 AraportID:AT1G01050 Length:212 Species:Arabidopsis thaliana


Alignment Length:175 Identity:55/175 - (31%)
Similarity:87/175 - (49%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PMHDIPLYANEEKTIYNMVVEVPRWTNAKMEISLKTPMNPIKQDIKKGKLRFVANCFPHKGYIWN 143
            |.||:.:.....: |:|:|||:.:.:..|.|:..||.:      ||..::.:.:..:||     |
plant    35 PWHDLEIGPGAPQ-IFNVVVEITKGSKVKYELDKKTGL------IKVDRILYSSVVYPH-----N 87

  Fly   144 YGALPQTWENPDHIEPSTGCKGDNDPIDVIEIGYRVAKRGDVLKVKVLGTIALIDEGETDWKIIA 208
            ||.:|:|.           |: |||||||:.|.......|..|:.:.:|.:.:||:||.|.||||
plant    88 YGFVPRTL-----------CE-DNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIA 140

  Fly   209 IDVNDPLASKVNDIADVDQYFPGLLRATVEWFKIYKIPDGKPENQ 253
            :.|:||......||.::.   |..|.....:|:.||    |.||:
plant   141 VCVDDPEYKHYTDIKELP---PHRLSEIRRFFEDYK----KNENK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nurf-38NP_523849.3 pyrophosphatase 26..292 CDD:469666 55/175 (31%)
PPa1NP_171613.1 PLN02373 25..212 CDD:178001 55/175 (31%)

Return to query results.
Submit another query.