DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nurf-38 and PPa4

DIOPT Version :10

Sequence 1:NP_523849.3 Gene:Nurf-38 / 37922 FlyBaseID:FBgn0016687 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_190930.1 Gene:PPa4 / 824530 AraportID:AT3G53620 Length:216 Species:Arabidopsis thaliana


Alignment Length:175 Identity:54/175 - (30%)
Similarity:87/175 - (49%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PMHDIPLYANEEKTIYNMVVEVPRWTNAKMEISLKTPMNPIKQDIKKGKLRFVANCFPHKGYIWN 143
            |.||:.: ..|...|:|.|||:.:.:..|.|:...|.:      ||..::.:.:..:||     |
plant    39 PWHDLEI-GPEAPIIFNCVVEIGKGSKVKYELDKTTGL------IKVDRILYSSVVYPH-----N 91

  Fly   144 YGALPQTWENPDHIEPSTGCKGDNDPIDVIEIGYRVAKRGDVLKVKVLGTIALIDEGETDWKIIA 208
            ||.:|:|.           |: |:|||||:.|.......|..|:.|.:|.:.:||:||.|.||||
plant    92 YGFIPRTL-----------CE-DSDPIDVLVIMQEPVIPGCFLRAKAIGLMPMIDQGEKDDKIIA 144

  Fly   209 IDVNDPLASKVNDIADVDQYFPGLLRATVEWFKIYKIPDGKPENQ 253
            :..:||.....|||:::..:....:|   .:|:.||    |.||:
plant   145 VCADDPEYRHYNDISELPPHRMAEIR---RFFEDYK----KNENK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nurf-38NP_523849.3 pyrophosphatase 26..292 CDD:469666 54/175 (31%)
PPa4NP_190930.1 PLN02373 29..216 CDD:178001 54/175 (31%)

Return to query results.
Submit another query.