DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nurf-38 and PPa3

DIOPT Version :10

Sequence 1:NP_523849.3 Gene:Nurf-38 / 37922 FlyBaseID:FBgn0016687 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_182209.1 Gene:PPa3 / 819299 AraportID:AT2G46860 Length:216 Species:Arabidopsis thaliana


Alignment Length:175 Identity:52/175 - (29%)
Similarity:87/175 - (49%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PMHDIPLYANEEKTIYNMVVEVPRWTNAKMEISLKTPMNPIKQDIKKGKLRFVANCFPHKGYIWN 143
            |.||:.: ..|...::|:|||:.:.:..|.|:..||.:      ||..::.:.:..:||     |
plant    39 PWHDLEI-GPEAPLVFNVVVEITKGSKVKYELDKKTGL------IKVDRILYSSVVYPH-----N 91

  Fly   144 YGALPQTWENPDHIEPSTGCKGDNDPIDVIEIGYRVAKRGDVLKVKVLGTIALIDEGETDWKIIA 208
            ||.:|:|.           |: ||||:||:.:.......|..|:.:.:|.:.:||:||.|.||||
plant    92 YGFIPRTL-----------CE-DNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIA 144

  Fly   209 IDVNDPLASKVNDIADVDQYFPGLLRATVEWFKIYKIPDGKPENQ 253
            :..:||   :.....|:.|..|..|:....:|:.||    |.||:
plant   145 VCADDP---EYKHFTDIKQLAPHRLQEIRRFFEDYK----KNENK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nurf-38NP_523849.3 pyrophosphatase 26..292 CDD:469666 52/175 (30%)
PPa3NP_182209.1 PLN02373 29..216 CDD:178001 52/175 (30%)

Return to query results.
Submit another query.