DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nurf-38 and PPa2

DIOPT Version :10

Sequence 1:NP_523849.3 Gene:Nurf-38 / 37922 FlyBaseID:FBgn0016687 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_179415.1 Gene:PPa2 / 816338 AraportID:AT2G18230 Length:218 Species:Arabidopsis thaliana


Alignment Length:46 Identity:13/46 - (28%)
Similarity:25/46 - (54%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 VSHALG-DYRVEKATDYEERIEGEKSERSSSPAFDSDEEHSTNVKQ 402
            ::|||. ..|..|......|::.:|..::|||:.:|.|:..|..::
plant   169 IAHALCLTERQIKIWFQNRRMKWKKENKASSPSSNSQEKQETEEEE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nurf-38NP_523849.3 pyrophosphatase 26..292 CDD:469666
PPa2NP_179415.1 PLN02373 31..218 CDD:178001 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.