DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nurf-38 and ppa2

DIOPT Version :9

Sequence 1:NP_523849.3 Gene:Nurf-38 / 37922 FlyBaseID:FBgn0016687 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001011461.1 Gene:ppa2 / 496951 XenbaseID:XB-GENE-961143 Length:289 Species:Xenopus tropicalis


Alignment Length:282 Identity:175/282 - (62%)
Similarity:213/282 - (75%) Gaps:1/282 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TVEKGAK-NSPSYSLYFKNKCGNVISPMHDIPLYANEEKTIYNMVVEVPRWTNAKMEISLKTPMN 117
            |||:.|| ||..|.|:|||..|..|||.|||||:|:|.|.|:||||||||||||||||:.|.|:|
 Frog     4 TVEQRAKANSLEYRLFFKNCKGQYISPFHDIPLFADEAKGIFNMVVEVPRWTNAKMEIATKDPLN 68

  Fly   118 PIKQDIKKGKLRFVANCFPHKGYIWNYGALPQTWENPDHIEPSTGCKGDNDPIDVIEIGYRVAKR 182
            |||||:||||||:|||.||||||||||||||||||||.||:.:||..||||||||.:||.:|..|
 Frog    69 PIKQDVKKGKLRYVANVFPHKGYIWNYGALPQTWENPSHIDENTGFGGDNDPIDVCDIGSKVCDR 133

  Fly   183 GDVLKVKVLGTIALIDEGETDWKIIAIDVNDPLASKVNDIADVDQYFPGLLRATVEWFKIYKIPD 247
            |||:|||:|||:|||||||||||||||:..||.||..|||.||.:..|..|.:||:||:.||:||
 Frog   134 GDVIKVKILGTLALIDEGETDWKIIAINAEDPEASHYNDIEDVRRLKPNYLESTVDWFRRYKVPD 198

  Fly   248 GKPENQFAFNGDAKNADFANTIIAETHKFWQNLVHQSPASGSISTTNITNRNSEHVIPKEEAEKI 312
            |||||||||:.:.||.|||..||..||:.|::||.:....|.|:.||:|.::|..:...||.|.|
 Frog   199 GKPENQFAFDAEFKNKDFAINIIKSTHEHWKSLVTKIIEGGEINCTNVTVQDSPFLSKAEEVESI 263

  Fly   313 LAEAPDGGQVEEVSDTVDTWHF 334
            :..||..|....|::.||.|::
 Frog   264 VKAAPPCGPPSPVAEDVDKWYY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nurf-38NP_523849.3 pyrophosphatase 26..292 CDD:294149 160/238 (67%)
ppa2NP_001011461.1 pyrophosphatase 2..241 CDD:320828 159/236 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 284 1.000 Domainoid score I1601
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5356
Inparanoid 1 1.050 363 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG53511
OrthoDB 1 1.010 - - D1398991at2759
OrthoFinder 1 1.000 - - FOG0001608
OrthoInspector 1 1.000 - - otm48251
Panther 1 1.100 - - O PTHR10286
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2162
SonicParanoid 1 1.000 - - X1018
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.