powered by:
Protein Alignment ITP and ZC168.2
DIOPT Version :9
Sequence 1: | NP_001036569.2 |
Gene: | ITP / 37921 |
FlyBaseID: | FBgn0035023 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_501985.1 |
Gene: | ZC168.2 / 191091 |
WormBaseID: | WBGene00013856 |
Length: | 108 |
Species: | Caenorhabditis elegans |
Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
Similarity: | 26/39 - (66%) |
Gaps: | 2/39 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 LDRICEDCYQLFRET--SIHRLCKANCFVHETFGDCLKV 88
::|||:.|::|...: ::...|:|:||..:.|.:|||:
Worm 56 MERICDMCHELSSHSRPNMRVECRADCFTTDAFRECLKL 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160158786 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR35981 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.990 |
|
Return to query results.
Submit another query.