DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ITP and ZC168.2

DIOPT Version :9

Sequence 1:NP_001036569.2 Gene:ITP / 37921 FlyBaseID:FBgn0035023 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_501985.1 Gene:ZC168.2 / 191091 WormBaseID:WBGene00013856 Length:108 Species:Caenorhabditis elegans


Alignment Length:39 Identity:13/39 - (33%)
Similarity:26/39 - (66%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LDRICEDCYQLFRET--SIHRLCKANCFVHETFGDCLKV 88
            ::|||:.|::|...:  ::...|:|:||..:.|.:|||:
 Worm    56 MERICDMCHELSSHSRPNMRVECRADCFTTDAFRECLKL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ITPNP_001036569.2 Crust_neurohorm 37..104 CDD:279488 13/39 (33%)
ZC168.2NP_501985.1 Crust_neurohorm <56..>93 CDD:279488 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR35981
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.990

Return to query results.
Submit another query.