DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13585 and Smim14

DIOPT Version :9

Sequence 1:NP_001163291.1 Gene:CG13585 / 37918 FlyBaseID:FBgn0035020 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001363900.1 Gene:Smim14 / 68552 MGIID:1915802 Length:99 Species:Mus musculus


Alignment Length:104 Identity:36/104 - (34%)
Similarity:55/104 - (52%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDGCECVWSQEYAMQRLINFIRQNQNACGDNECYDVTGRTPHQAQIAGRGDDSGFSVAMI---FL 66
            ||.||||.|.|:||:||||.:||:|:.|.|.||.         .::.|...|||.|:.:|   ::
Mouse     6 FDPCECVCSHEHAMRRLINLLRQSQSYCTDTECL---------RELPGPSSDSGISITVILMAWM 61

  Fly    67 IVAMFMYIVNPSTWGNFTSNKRAGGRRDNNQDGSPPQPP 105
            ::||.::::.|.   |...:...|.....:....||.||
Mouse    62 VIAMLLFLLRPP---NLRGSSLPGKPSSPHSGQDPPAPP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13585NP_001163291.1 DUF2615 2..99 CDD:287941 32/96 (33%)
Smim14NP_001363900.1 DUF2615 3..97 CDD:402563 34/102 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..99 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836736
Domainoid 1 1.000 67 1.000 Domainoid score I9823
eggNOG 1 0.900 - - E1_2BVGC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5333
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007346
OrthoInspector 1 1.000 - - oto94227
orthoMCL 1 0.900 - - OOG6_108129
Panther 1 1.100 - - LDO PTHR31019
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5465
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.