DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13585 and smim14

DIOPT Version :9

Sequence 1:NP_001163291.1 Gene:CG13585 / 37918 FlyBaseID:FBgn0035020 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001016053.2 Gene:smim14 / 548807 XenbaseID:XB-GENE-5732314 Length:103 Species:Xenopus tropicalis


Alignment Length:107 Identity:43/107 - (40%)
Similarity:65/107 - (60%) Gaps:15/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFDGCECVWSQEYAMQRLINFIRQNQNACGDNECY-DVTGRTPHQAQIAGRGDDSGFSVAMI--- 64
            :||.|||:.|.|:||:||||.:||:|:.|.||||: ::.|  |:.:      .|.||::|||   
 Frog     5 NFDPCECICSHEHAMRRLINLLRQSQSYCTDNECFQELPG--PNSS------TDGGFNIAMIAMA 61

  Fly    65 FLIVAMFMYIVNP-STWGNFTSNKRAGGRRDNNQDGSPPQPP 105
            :|::.:.:|::.| |..||..|.|  .....:||...||.||
 Frog    62 WLVIGVTLYLLRPRSLRGNGPSAK--PNSPHSNQGPEPPAPP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13585NP_001163291.1 DUF2615 2..99 CDD:287941 39/99 (39%)
smim14NP_001016053.2 DUF2615 3..101 CDD:371347 41/105 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11768
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5285
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588274at2759
OrthoFinder 1 1.000 - - FOG0007346
OrthoInspector 1 1.000 - - oto104433
Panther 1 1.100 - - LDO PTHR31019
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8967
SonicParanoid 1 1.000 - - X5465
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.