DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13585 and smim14

DIOPT Version :9

Sequence 1:NP_001163291.1 Gene:CG13585 / 37918 FlyBaseID:FBgn0035020 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_991165.1 Gene:smim14 / 402894 ZFINID:ZDB-GENE-040426-22 Length:103 Species:Danio rerio


Alignment Length:103 Identity:38/103 - (36%)
Similarity:60/103 - (58%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDGCECVWSQEYAMQRLINFIRQNQNACGDNEC-YDVTGRTPHQAQIAGRGDDSGFSVAMIFLIV 68
            ||.|||:.|.|:||:||||.:||:|:.|.|.|| .|:.|  |:.:.   .||.:...:.|.:|::
Zfish     6 FDPCECICSHEHAMRRLINLLRQSQSYCTDTECLQDMPG--PNSSV---EGDITIPMIIMGWLVL 65

  Fly    69 AMFMYIVNPSTW-GNFTSNKRAGGRRDNNQDGSPPQPP 105
            |:.:::..|::. |...:||..|..  .|:...||.||
Zfish    66 ALVLFLFRPASMRGPSANNKPIGPH--GNRGREPPAPP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13585NP_001163291.1 DUF2615 2..99 CDD:287941 34/95 (36%)
smim14NP_991165.1 DUF2615 3..100 CDD:287941 36/100 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580225
Domainoid 1 1.000 63 1.000 Domainoid score I10281
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5377
OMA 1 1.010 - - QHG48617
OrthoDB 1 1.010 - - D1588274at2759
OrthoFinder 1 1.000 - - FOG0007346
OrthoInspector 1 1.000 - - oto41060
orthoMCL 1 0.900 - - OOG6_108129
Panther 1 1.100 - - LDO PTHR31019
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8967
SonicParanoid 1 1.000 - - X5465
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.