DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13585 and Smim14

DIOPT Version :9

Sequence 1:NP_001163291.1 Gene:CG13585 / 37918 FlyBaseID:FBgn0035020 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001032881.1 Gene:Smim14 / 364154 RGDID:1311122 Length:99 Species:Rattus norvegicus


Alignment Length:104 Identity:34/104 - (32%)
Similarity:55/104 - (52%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDGCECVWSQEYAMQRLINFIRQNQNACGDNECYDVTGRTPHQAQIAGRGDDSGFSVAMI---FL 66
            ||.|||:.|.|:||:||||.:||:|:.|.|.||.         .::.|...|||.|:.:|   ::
  Rat     6 FDPCECICSHEHAMRRLINLLRQSQSYCTDTECL---------RELPGPSGDSGISITVILMAWM 61

  Fly    67 IVAMFMYIVNPSTWGNFTSNKRAGGRRDNNQDGSPPQPP 105
            ::|:.::::.|.   |...:...|.....:....||.||
  Rat    62 VIAVLLFLLRPP---NLRGSSLPGKPSSPHSGQDPPAPP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13585NP_001163291.1 DUF2615 2..99 CDD:287941 30/96 (31%)
Smim14NP_001032881.1 DUF2615 3..97 CDD:402563 32/102 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..99 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340436
Domainoid 1 1.000 65 1.000 Domainoid score I9828
eggNOG 1 0.900 - - E1_2BVGC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5267
OMA 1 1.010 - - QHG48617
OrthoDB 1 1.010 - - D1588274at2759
OrthoFinder 1 1.000 - - FOG0007346
OrthoInspector 1 1.000 - - oto97747
orthoMCL 1 0.900 - - OOG6_108129
Panther 1 1.100 - - LDO PTHR31019
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5465
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.