DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13585 and SMIM14

DIOPT Version :9

Sequence 1:NP_001163291.1 Gene:CG13585 / 37918 FlyBaseID:FBgn0035020 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001304825.1 Gene:SMIM14 / 201895 HGNCID:27321 Length:99 Species:Homo sapiens


Alignment Length:104 Identity:36/104 - (34%)
Similarity:55/104 - (52%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDGCECVWSQEYAMQRLINFIRQNQNACGDNECYDVTGRTPHQAQIAGRGDDSGFSVAMI---FL 66
            ||.||||.|.|:||:||||.:||:|:.|.|.||..         ::.|...|:|.||.||   ::
Human     6 FDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQ---------ELPGPSGDNGISVTMILVAWM 61

  Fly    67 IVAMFMYIVNPSTWGNFTSNKRAGGRRDNNQDGSPPQPP 105
            ::|:.::::.|.   |...:...|.....:....||.||
Human    62 VIALILFLLRPP---NLRGSSLPGKPTSPHNGQDPPAPP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13585NP_001163291.1 DUF2615 2..99 CDD:287941 32/96 (33%)
SMIM14NP_001304825.1 DUF2615 3..97 CDD:402563 34/102 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..99 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146781
Domainoid 1 1.000 67 1.000 Domainoid score I9863
eggNOG 1 0.900 - - E1_2BVGC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5352
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48617
OrthoDB 1 1.010 - - D1588274at2759
OrthoFinder 1 1.000 - - FOG0007346
OrthoInspector 1 1.000 - - oto90637
orthoMCL 1 0.900 - - OOG6_108129
Panther 1 1.100 - - LDO PTHR31019
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8967
SonicParanoid 1 1.000 - - X5465
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.