DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13585 and C34C12.4

DIOPT Version :9

Sequence 1:NP_001163291.1 Gene:CG13585 / 37918 FlyBaseID:FBgn0035020 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_497715.2 Gene:C34C12.4 / 183200 WormBaseID:WBGene00007923 Length:101 Species:Caenorhabditis elegans


Alignment Length:113 Identity:33/113 - (29%)
Similarity:55/113 - (48%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DGCECVWSQEYAMQRLINFIRQNQNACGDNECYDVTGRTPHQAQIAGRGDDSGFSVAMIFLIVAM 70
            |.|||.:..|.|||||:..:|.:|..|.|..| |..|       ::..|.::.....:::..:||
 Worm     3 DPCECFFDHESAMQRLLAMLRNSQADCTDTGC-DNDG-------LSREGGNTMMMWTLLWTFMAM 59

  Fly    71 FMYIVNPSTWGNFTSNKRAG---------GRRDNNQDGSPPQPPPPAI 109
            .:|::.|:   :..|::|..         |..|:|   :||.|||.|:
 Worm    60 ALYVMRPN---SMRSDRRTADDAAIEKPTGSSDDN---TPPPPPPSAM 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13585NP_001163291.1 DUF2615 2..99 CDD:287941 27/101 (27%)
C34C12.4NP_497715.2 DUF2615 3..91 CDD:287941 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159018
Domainoid 1 1.000 50 1.000 Domainoid score I7847
eggNOG 1 0.900 - - E1_2BVGC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I4102
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48617
OrthoDB 1 1.010 - - D1588274at2759
OrthoFinder 1 1.000 - - FOG0007346
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108129
Panther 1 1.100 - - LDO PTHR31019
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8967
SonicParanoid 1 1.000 - - X5465
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.