DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60e and Ir7d

DIOPT Version :9

Sequence 1:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:546 Identity:104/546 - (19%)
Similarity:206/546 - (37%) Gaps:133/546 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVIKMISFLLVSVLLCLVGA---SDSESMQVQVLQDLNLALQT---------ELNVFIDFECCAT 53
            |.|:.:..||:.  ||.|.|   .....::.|:...::..||.         ...|||       
  Fly     1 MDIRCVVALLLG--LCKVQAVVWPHQHLLEEQLASQISATLQKIFINGLAVYNFGVFI------- 56

  Fly    54 SEILHKLDSPRILLSSNSREARDLRIRGNFTESTLIIVSVMDSDLN-PLVASLLPRLL------- 110
            |....::|..|::|....       :..|.......:..|:.|.:| .:.|.:..:||       
  Fly    57 STSYEEMDRDRVILVHQV-------LNRNLYPPNFPVAVVLASKMNRKITAQVFTQLLFVQNAEQ 114

  Fly   111 -------DELHELHIVFLSNEEPGFP-KQDLYTYCFKEGF-VNVIL----MSGKGLYSYLPY--- 159
                   ...:.|.::.|...:|..| ...::||..:|.: :||::    :.|...::..||   
  Fly   115 AIAIAEGVNRNGLCVIVLLTSQPERPIMTKIFTYFMQERYNINVVILVPRLHGVQAFNVRPYTPT 179

  Fly   160 --PSIQPISL----SNVSEYFDRARIIRNFQGFPVRILRSTLAPR---DFEYSNEQGGLVRAGYL 215
              .|::|:.:    .::.:.|.|.  ::|..|.|:.::...:.|.   :::.|:...||.....|
  Fly   180 SCSSLEPVEIDIKDGDLWDVFPRR--LKNLHGCPLSVIVWDIPPYMRINWKSSDPMDGLDGLDGL 242

  Fly   216 FTAVKELTYRYNATIESVPIPDLPE---------YDVYLAVAEMLHTKKIDI-----VCYFKDFS 266
            ...:  :..:.|.|::.  ||:.|.         ...:....:||..::.:|     .| ..:.|
  Fly   243 LLRI--VARKMNFTLKL--IPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCAAC-TPERS 302

  Fly   267 LEVAYTAPLSIIREYFMAPHARPISSYLYYSK---PFGWTLWAVVISTVLYGTVMLHLAARGARV 328
            ..:..|:|.|.: .|.:...||  ..|..|..   ||....| :::||:|    .||... |:|.
  Fly   303 TFLEATSPYSQM-SYIIVLQAR--GGYSIYEVMLFPFEKYTW-LLLSTIL----GLHWIV-GSRW 358

  Fly   329 EIGKCLLYSLSHILYNCHQKIRVAGWRDVAIHGILTIGGFILTNVYLATLSSILTSGLYDEEYNT 393
            .:...:|                |||       :|.|  |::...|.|::.:.:.:........|
  Fly   359 RMPSPIL----------------AGW-------MLWI--FVIRASYEASVFNFIQNSPVKPSPRT 398

  Fly   394 LEDLARAPYPSLHDE-YYRSQMKAKTFLPERL--RRNSLSLNATLLKA-YRDGLNQSYIYIL--- 451
            |:......:..:.|. .||..:|..:|..:.|  ....:.:...|||| ::.|...|..::.   
  Fly   399 LDQALSGGFRFITDHASYRMTLKIPSFQGKTLISAGQPVDVFDALLKAPWKTGAFTSRAFLADHL 463

  Fly   452 ---YEDRLELILMQQYLLKTPRFNMI 474
               .:.|.:|:::.:.::.    ||:
  Fly   464 VRHRKHRNQLVILAEKIVD----NML 485



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.