DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60e and Ir94h

DIOPT Version :9

Sequence 1:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster


Alignment Length:559 Identity:111/559 - (19%)
Similarity:199/559 - (35%) Gaps:110/559 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PRILLSSNSREA--RDLRIRGNFT--ESTLIIVSVMDSDLNPLVASLLPRLLDELHELHIVF-LS 122
            ||.:||::.:..  |:....|.:.  .|.|.:::.:.|........||...|.....:.::. :.
  Fly    47 PRTILSNHPQIIWFREETYPGLYKRHSSNLFVMACLSSTSYDGQLQLLAESLTRYRSVRVLIEVQ 111

  Fly   123 NEEPGFPKQDLYTYCFKEGFVNVILMSGK-----GLYSYLPYP-----------SIQPISLSNVS 171
            ::|..|....:...|.:...:||:|...:     .::|||.:|           |::|....|. 
  Fly   112 DKEGSFLASQILLLCQQHSMLNVVLYFSRWTRTLNVFSYLAFPYFKLLKQRLSGSLRPKIFINQ- 175

  Fly   172 EYFDRARIIRNFQGFPVRILRSTLAPRDFEYSNEQGGLVRAGYLFTAVKELTYRYNATIESVPIP 236
                    :::.||:.:|:......|..|.|.:..|.....|:|:..|:..:.......: |..|
  Fly   176 --------LKDLQGYKIRVQPDLSPPNSFSYRDRHGECQVGGFLWRIVENFSKSLKGDTQ-VLYP 231

  Fly   237 DLPEYDVYLAVAEMLHTKKIDIVCYFKDFSLEVAYTAPLSIIREYFMAPHARPISSYLYYSKPFG 301
            ...:..|  :.||.:       :.:.::.|.::..|..:...:      |......|.|......
  Fly   232 TWAKAKV--SAAEYM-------IQFTRNGSSDIGVTTTMITFK------HEERYRDYSYPMYDIS 281

  Fly   302 WTLWAVVISTVLYGTVMLHLAARGARVEIGKCLLYSLSHILY--NCHQKIRVAGWRDVAIHG-IL 363
            |.....|...:....:..|:.:.|:      .||..|:.||:  ...|.|:..|   :...| ::
  Fly   282 WCTMLPVEKPLSVEILFSHVLSPGS------ALLLILAFILFFLIVPQLIKCLG---ITFRGRLI 337

  Fly   364 TIGGFILTNVYL----ATLSSILTSGLYDEEYNTLEDLARAPYP--SLHDEYYRSQMKAKTFLPE 422
            .:...|...|.|    |.|.|:|.|........:.:||..:...  .:..|.|        ||..
  Fly   338 GMASRIFALVMLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELY--------FLDG 394

  Fly   423 RLRRN-----SLSLNATLLKAYRDGLNQSYIYILYEDRLELILMQQYLLKTPRFNMIRQAVGFTL 482
            ..|..     .|:.|...|...|:..|.|:.|.:...:..:|..||.....|.|..        .
  Fly   395 GFRAKYASAFHLTENPNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRY--------S 451

  Fly   483 ESYCVSNSLPY--LAMTSEFMRRLQEH--------GISIKMKADTFRELIHQGIYT--------L 529
            ...|.|:..|:  |.....|.|...:|        |:..:....:|.|::..|..|        |
  Fly   452 TDLCFSSETPWGLLIAPESFYREPLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIKDYSRTNL 516

  Fly   530 MRDDEPPAKAFDLDYYFFAFVLWTVGLISSLLVFFAELV 568
            |:    |.:..||..   .:|::.|||.:|.:||..||:
  Fly   517 MK----PLRIQDLRK---CWVIFAVGLGTSTVVFTIELL 548



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.