DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60e and Ir94g

DIOPT Version :9

Sequence 1:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster


Alignment Length:533 Identity:100/533 - (18%)
Similarity:203/533 - (38%) Gaps:89/533 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 REARDLRIRGNFTESTLIIVSVMDSDLNPLVASLLPRLLDELHELHIVF-LSNEEPGFPKQDLYT 135
            |..|.:.:.|...|..|::..:.......|:.| |.|.|..|.:..|:. |..:...|...::..
  Fly    54 RTDRTVILNGFIGEGLLVLACLPGFHWRALLGS-LARSLKYLRQARILIELMQDRDEFLVSEVLQ 117

  Fly   136 YCFKEGFVNVILM-----SGKGLYSYLPYPSIQPISL-----SNVSEYFDRARIIRNFQGFPVRI 190
            :|..:..:||..:     ..:.|.|:..|||.:.::.     :.||:.:....:  |.:|..:|.
  Fly   118 FCLSQDMINVNAIFDDFPETENLSSFEAYPSFEVVNQTFTPDTQVSDLYPNKML--NLRGGVIRT 180

  Fly   191 LRSTLAPRDFEYSNEQGGLVRAGYLFTAVKELTYRYNATIESVP--IPDLPEYDVYLAVAEMLHT 253
            :.....|....|.:::|.....|||:..::...:::||.::.|.  ..|.|     |...|:|..
  Fly   181 MPDYSEPNTILYQDKEGNKEILGYLWDLLEAYAHKHNAQLQVVNKYADDRP-----LNFIELLDA 240

  Fly   254 KKIDIVCYFKDFSLEVAYTAPLSIIREYFMAPHAR--------PISSYLYYSKPFGWTLWAVVIS 310
            .:..|:    |....:...:..|:.|.:.|:....        |:...|:.|:        ::..
  Fly   241 AQSGII----DVGASIQPMSMGSLSRMHEMSYPVNQASWCTMLPVERQLHVSE--------LLTR 293

  Fly   311 TVLYGTVMLHLAARGARVEIGKCLLYSLSHIL---YNCHQKIRVAGWRDVAIHGILTIGGFILTN 372
            .:.|.|:.|.|            ||:....:|   :..|.:::..||        |.:...:.:|
  Fly   294 VIPYPTLALLL------------LLWIFYEVLRGRWRRHSRLQSIGW--------LVLATLVSSN 338

  Fly   373 VYLATLSSILTSGLYDEEYNTLEDLARAPYP--SLHDEYYRSQMKAKTFLPERLRRNSLSLNATL 435
             |:..|.::.|........|:|..|..:|..  |:..||...:...:|.......   |:|:|::
  Fly   339 -YVGKLLNLFTDPPSLPPVNSLAALMESPVRIISIRSEYSAIEFTQRTKYSAAFH---LALHASI 399

  Fly   436 LKAYRDGLNQSYIYILYEDRLELILMQQYLLKTPRFNMIRQAVGFTLESYCVSNSLPY-LAMTSE 499
            |...|:..|.||.|.:..::.::...||.....|.|...:        ..|....:|: |.:...
  Fly   400 LIGLRNAFNTSYGYTITSEKWKIYEEQQKRSSKPVFRYSK--------DLCFYEMIPFGLVIPEN 456

  Fly   500 FMRRLQEHGISIKMKADTFREL-IHQGIYTLMR---------DDEPPAKAFDLDYYFFAFVLWTV 554
            ...|...|..::.::.....:. :::|...:::         .:...||...:......|:::..
  Fly   457 SPHRAPLHSYTLLLRQAGLHDFWVNRGFSYMVKAGKINFTAVGERYEAKTLTITDLRNVFIIYVS 521

  Fly   555 GLISSLLVFFAEL 567
            .|:.||::|..||
  Fly   522 VLLISLILFTCEL 534



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.