DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60e and Ir87a

DIOPT Version :10

Sequence 1:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:215 Identity:51/215 - (23%)
Similarity:83/215 - (38%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 GFILTNVYLATLSSILTSGLYDEEYNTLEDLARAPYPSLHDEYYRSQMKAKTFLPERLRRNSLSL 431
            ||..:|.|.:.|.|.||:.....:.:||:            |.|.::|.... ..|.:|.  |:.
  Fly   569 GFFFSNTYQSFLISTLTTPRSSYQIHTLQ------------EIYSNKMTVMG-TSEHVRH--LNK 618

  Fly   432 NATLLKAYRDGLNQSYIYI------LYEDRLELILMQQYLLKTPRFNMIRQAVGFTLES---YCV 487
            :..:.|..|:.....|..:      ...:.:.:.:.:|:....||....|.......||   |.|
  Fly   619 DGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESLYVYLV 683

  Fly   488 SNSLP----YLAMTSEFMRRLQEHGISIKMKAD-TFRELIHQGIYTLMRDDEPPAKAFDLDYYFF 547
            :..||    .|...:..::.:.|.|...|...| ..|.:||:.| |.:|:|  |.||...|.:..
  Fly   684 TMLLPKKYHLLHQINPVIQHIIESGHMQKWARDLDMRRMIHEEI-TRVRED--PFKALTFDQFRG 745

  Fly   548 AFVLWTVGLISSLLVFFAEL 567
            |.......|:.:..||..||
  Fly   746 AIAFSGGLLLVASCVFAFEL 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir60eNP_611927.3 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 405..>476 CDD:473866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.