DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60e and Ir7g

DIOPT Version :9

Sequence 1:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster


Alignment Length:608 Identity:131/608 - (21%)
Similarity:226/608 - (37%) Gaps:181/608 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ILHKLDSPRILLSSNSREARDLRIRGNFTESTLIIVSVMDSDLNPLVASLLPRLLD-ELH----- 114
            :|.:|..||             ||.|..|.:.|::.|             |..||| |:|     
  Fly    81 VLVELGRPR-------------RIAGPRTHNLLLVDS-------------LDALLDIEIHTYTAQ 119

  Fly   115 ----ELHIVFLSNEEPGFP--KQDLYTYCFKEGFV--NVILMSGKG---LYSYLPYP-----SIQ 163
                |.:.:||...:...|  .|.::.||::...:  ||:..|..|   |::|.||.     ..|
  Fly   120 SDTSEYYFIFLQQRDALIPHDMQGVFAYCWRHQLINCNVMTQSSGGQVLLHTYFPYAPGQCNDSQ 184

  Fly   164 PISLS-------NVSEYFDRARIIRNFQGFPVRILRSTLAP-RDF-EYSNEQGGLVRAGYLFTAV 219
            |..::       ...:||...  :.|..|.|:.:|...::| .|. |...|..||  .|.|   :
  Fly   185 PTRINMFLGESWKHRDYFPSK--LHNLNGCPLIVLARKVSPFLDLDEGQRELRGL--EGRL---L 242

  Fly   220 KELTYRYNATIESVPIPD-----------------LPEYDVYLAVAEMLHTKKIDIVCYFKDFSL 267
            :||:.|.|.:|:...:.|                 :.|...:||:.   :.:|            
  Fly   243 QELSRRMNFSIQFSGLQDQLKNRTTWTEKQLLQKLVQERIAHLAIG---YVRK------------ 292

  Fly   268 EVAYTAPLSIIREYF-------MAPHARPISSYLYYSKPFGWTLWAVVISTVLYGTVMLHLAARG 325
            .:.|...|:.:..::       :..:|..::|...:|.||....|..::.:.|..:.:..|..||
  Fly   293 RIQYATNLTPVFPHYSNRVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALLHXRG 357

  Fly   326 ARVEIGKCL-LYSLS-------------HILYNCHQKIRVAGWRDVAIHGILTIGGFILTNVYLA 376
            |...:...| :|:.|             .:|:        |.|         .|.|.|:.::|.|
  Fly   358 AGDRLALVLAVYAASLGLPIDPPERPSLQLLF--------ASW---------LIFGLIVRSMYSA 405

  Fly   377 TLSSILTSGLYDEEYNTLEDLARAPY---------------PSLHDEYYRSQMKAKTFLPERLRR 426
            .|..||...|:......|:||....|               |||.|   ...:|:.....||...
  Fly   406 LLFFILRYHLHQRLPGNLQDLTHGDYAAVMGRTTLQDLREVPSLQD---LLGLKSVIVTSEREEE 467

  Fly   427 NSLSLNATLLKAYRDGLNQSYIY--ILYEDRLELILMQQ------YLLKTPRFNMIRQAVGFTLE 483
            ...:|:...|   |:|.....::  ::.:|.| |.|.|:      |.: .|: :::.|.:...|:
  Fly   468 VLRTLDRCTL---REGAGSHPLFFGLISQDAL-LHLTQRGHRAGAYHI-IPQ-DVLEQQLAIYLQ 526

  Fly   484 SYC-VSNSLPYLAMTSEFMRRLQEHGISIKMKADTFRELIHQGIYTLMRDDEPPAKAFDLDYYFF 547
            .:. :::.|.:|.|:...: .|..|..........||.   :.:|...|..:|     ||    :
  Fly   527 KHSHLASHLDHLVMSIRSV-GLVHHWAGQMASERYFRS---RFLYREKRIRQP-----DL----W 578

  Fly   548 AFVLWTVGL-ISSLLVFFAELVS 569
            |..:.|.|| :.||:||..||::
  Fly   579 AVYILTAGLYLLSLVVFICELLA 601



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.