DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir60e and Ir7a

DIOPT Version :9

Sequence 1:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:628 Identity:117/628 - (18%)
Similarity:211/628 - (33%) Gaps:222/628 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLCLVGASDSESMQVQVLQDLNLALQTELNVFIDFECCA---TSEILHKLDSPRILLSSNSREAR 75
            |:.|.....|.:.::|||:|::             ..|.   ||.:        |||:    |.|
  Fly   126 LILLTHRMSSRAERLQVLRDIS-------------RTCVRFHTSNV--------ILLT----EKR 165

  Fly    76 DLRIRGNFTESTLIIVSV----MDSDLNPLVASLLPRLLDELHELHIVFLSNEEPGFPKQDLY-T 135
            |         ..:::.:.    ||.||:.              .|.::            |:| .
  Fly   166 D---------GVVLVYAYRLLNMDCDLSV--------------NLELI------------DIYKN 195

  Fly   136 YCFKEG-----FVNVILMSGKGL-YSYLPYPSIQPISLSNVSEYFDRARIIR--NFQGFPVRILR 192
            ..|:.|     |..|:.:||..| .|:.|.|..... :.|.|:..:||:|.|  ...|..:::|.
  Fly   196 GLFRHGHEARSFNRVLSLSGCPLQVSWYPLPPFVSF-IGNSSDPEERAQIWRLTGIDGELIKLLA 259

  Fly   193 STLAPRDFEYSNEQGGLVRAGYLFTAVKELTYRYNATIESVPIPDLPE-----YD-VYLAVAEML 251
            |..   ||....|:                  ..|..:.    ||:.:     :| |.::.:.:|
  Fly   260 SIF---DFRILLEE------------------PCNKCLS----PDIKDDCSGCFDQVIISNSSIL 299

  Fly   252 ---------HTKKIDIVCYFKDFSLEVAYTAPLSIIREYFMAPHARPISSYLYYSKPFGWTLW-A 306
                     |.........:...||             .|:...:....:....:.||...:| |
  Fly   300 IGAMSGSHQHRSHFSFTSSYHQSSL-------------VFIMHMSSQFGAVAQLAVPFTVIVWLA 351

  Fly   307 VVISTVLYGTVMLHLAARG----ARVEIGKCLLYSLSHILYN----------CHQKIRVAGWRDV 357
            :|:|::|   ::|.|..|.    .|.::....|..|:.::.|          ...:|..|||   
  Fly   352 LVVSSLL---LVLVLWMRNRLVCGRSDLASHALQVLTTLMGNPLEARSLPRSSRLRILYAGW--- 410

  Fly   358 AIHGILTIGGFILTNVYLATLSSILTSGLYDEEYNTLEDLARAPYPSLHDEYYRSQMKAKTFLPE 422
                :|.:  .:|..||...|........:......:.:|.|:.|..::.||.       .:.|.
  Fly   411 ----LLLV--LVLRVVYQGKLFDSFRLPYHKPLPTEISELIRSNYTLINQEYL-------DYYPR 462

  Fly   423 RLRRNSLSLNATLLKAYRDGLNQSYIYI-------LYEDRLELILMQQYLL---KTPRFNMIRQA 477
            .|         |:|.  |:|....:.||       .:.....:..|:.|.:   .|.|...|::.
  Fly   463 EL---------TVLT--RNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEH 516

  Fly   478 VGFTLESYCVSNSLPYLAMTSEFMRRLQEHGISIKMKAD-TFRELIHQGI--YTLMRDDE-PPAK 538
            :              :|.....::||   |.: :|...| ..::|:..||  |.:...|. ...|
  Fly   517 I--------------FLYQMVIYLRR---HSL-LKFAFDRKIKQLLSAGIIGYFVREFDACQYRK 563

  Fly   539 AFDLDY------------YFFAFVLWTVGLISSLLVFFAELVS 569
            .|:.||            .::..::|   |.::::.|..||:|
  Fly   564 PFEEDYEVTPIPLDSFCGLYYISLIW---LSAAVVAFILELLS 603



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.