Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005269298.1 | Gene: | SART3 / 9733 | HGNCID: | 16860 | Length: | 981 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 49/204 - (24%) |
---|---|---|---|
Similarity: | 90/204 - (44%) | Gaps: | 23/204 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 NSSPDSGKIYIKNLERSI---DNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARA 168
Fly 169 AIE----KVNGMLCNNQKVHVVKFIPRRDREQEKATHFK------NLYVKNLSEEFTEQHLREMF 223
Fly 224 EPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQE 288
Fly 289 INRKLEERK 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 19/76 (25%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 18/85 (21%) | ||
SART3 | XP_005269298.1 | RNA14 | 100..>478 | CDD:227438 | |
NRDE-2 | 351..>504 | CDD:285605 | |||
RRM | 654..876 | CDD:223796 | 38/165 (23%) | ||
RRM1_SART3 | 723..796 | CDD:240837 | 19/78 (24%) | ||
RRM2_SART3 | 817..897 | CDD:240838 | 19/82 (23%) | ||
LSM_int_assoc | 895..951 | CDD:293211 | 5/16 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.861654 | Normalized mean entropy | S4474 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |