DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and SART3

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_005269298.1 Gene:SART3 / 9733 HGNCID:16860 Length:981 Species:Homo sapiens


Alignment Length:204 Identity:49/204 - (24%)
Similarity:90/204 - (44%) Gaps:23/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSGKIYIKNLERSI---DNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARA 168
            :||.||..:::.||..|:   |.| :...|...|.::.........|:.|||.:|.|..|::|..
Human   716 DSSKDSITVFVSNLPYSMQEPDTK-LRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQ 779

  Fly   169 AIE----KVNGMLCNNQKVHVVKFIPRRDREQEKATHFK------NLYVKNLSEEFTEQHLREMF 223
            |:|    .|.|     :.:.|...:.:......|...:.      .|::..|....|::.|.|:.
Human   780 ALEMDRKSVEG-----RPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEIC 839

  Fly   224 EPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQE 288
            :.:|.:...:|:.:..|:.:...:|.|||...|..||:.:.|..:.:|   .:..|:|... |::
Human   840 KAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKEN---IIKVAISNPP-QRK 900

  Fly   289 INRKLEERK 297
            :..|.|.||
Human   901 VPEKPETRK 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/76 (25%)
RRM3_I_PABPs 202..282 CDD:240826 18/85 (21%)
SART3XP_005269298.1 RNA14 100..>478 CDD:227438
NRDE-2 351..>504 CDD:285605
RRM 654..876 CDD:223796 38/165 (23%)
RRM1_SART3 723..796 CDD:240837 19/78 (24%)
RRM2_SART3 817..897 CDD:240838 19/82 (23%)
LSM_int_assoc 895..951 CDD:293211 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861654 Normalized mean entropy S4474
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.