DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and SPAC222.18

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001343068.1 Gene:SPAC222.18 / 9407033 PomBaseID:SPAC222.18 Length:111 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:22/89 - (24%)
Similarity:44/89 - (49%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
            ||::|...:...:.|.:.||.:|||....:.:....::.|:.||.:|..:.|..|...:...::|
pombe    20 LYIRNFGTDMRARTLGQAFEKWGRIVRCDIPISSNPQAHRYAFVEFEEREKAELAHEKMRNAKIG 84

  Fly   270 DNKFLYVARALSKAERQQEINRKL 293
             |..::|..|.|:....::..|:|
pombe    85 -NDIIFVEWAKSRERYHRDDKRRL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825
RRM3_I_PABPs 202..282 CDD:240826 19/76 (25%)
SPAC222.18NP_001343068.1 RRM_SF 19..94 CDD:327398 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.