Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_444344.1 | Gene: | Pabpc5 / 93728 | MGIID: | 2136401 | Length: | 381 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 91/215 - (42%) |
---|---|---|---|
Similarity: | 131/215 - (60%) | Gaps: | 20/215 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 SSPDS-------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEA 165
Fly 166 ARAAIEKVNGMLCNNQKVHVVKF-IPRRD----REQEKATHFKNLYVKNLSEEFTEQHLREMFEP 225
Fly 226 YGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEIN 290
Fly 291 R-----KLEERKRQKAGQIF 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 37/69 (54%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 33/79 (42%) | ||
Pabpc5 | NP_444344.1 | RRM1_I_PABPs | 21..97 | CDD:240824 | 2/3 (67%) |
ELAV_HUD_SF | 28..270 | CDD:273741 | 78/179 (44%) | ||
RRM2_I_PABPs | 103..178 | CDD:240825 | 39/75 (52%) | ||
RRM3_I_PABPs | 197..276 | CDD:240826 | 33/79 (42%) | ||
RRM_SF | 300..376 | CDD:302621 | 1/5 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG52254 | |
OrthoDB | 1 | 1.010 | - | - | D1027234at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24012 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.120 |