DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Pabpc5

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_444344.1 Gene:Pabpc5 / 93728 MGIID:2136401 Length:381 Species:Mus musculus


Alignment Length:215 Identity:91/215 - (42%)
Similarity:131/215 - (60%) Gaps:20/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SSPDS-------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEA 165
            |.||.       |.|:||||:::|||:|::..||.|||||:|.|..|::| |:||.:|||||..|
Mouse    93 SQPDDRLRKSGVGNIFIKNLDKTIDNRALFYLFSAFGNILSCKVVCDDNG-SKGYAYVHFDSLAA 156

  Fly   166 ARAAIEKVNGMLCNNQKVHVVKF-IPRRD----REQEKATHFKNLYVKNLSEEFTEQHLREMFEP 225
            |..||..:||:..||::|:|.:| .|...    |.:|:|| |.|::|||..::..::.|.::|..
Mouse   157 ANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRERAT-FTNVFVKNFGDDIDDEKLNKLFSE 220

  Fly   226 YGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEIN 290
            ||...|.|::.|..|:|:.||||.||..::|..||:.||||.: |.|.|.|.||..|.||..|:.
Mouse   221 YGPTESVKVIRDATGKSKGFGFVRYETHEAAQKAVLELHGKSI-DGKVLCVGRAQKKIERLAELR 284

  Fly   291 R-----KLEERKRQKAGQIF 305
            |     ||:|:.|.....|:
Mouse   285 RRFERLKLKEKNRPSGVPIY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 37/69 (54%)
RRM3_I_PABPs 202..282 CDD:240826 33/79 (42%)
Pabpc5NP_444344.1 RRM1_I_PABPs 21..97 CDD:240824 2/3 (67%)
ELAV_HUD_SF 28..270 CDD:273741 78/179 (44%)
RRM2_I_PABPs 103..178 CDD:240825 39/75 (52%)
RRM3_I_PABPs 197..276 CDD:240826 33/79 (42%)
RRM_SF 300..376 CDD:302621 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52254
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.120

Return to query results.
Submit another query.