DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PABPC4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001129125.1 Gene:PABPC4 / 8761 HGNCID:8557 Length:660 Species:Homo sapiens


Alignment Length:191 Identity:96/191 - (50%)
Similarity:137/191 - (71%) Gaps:5/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |.::||||::||||||:|||||.|||||:|.|..||:| |:||.||||:::|||..||||:||||
Human    99 GNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGML 162

  Fly   178 CNNQKVHVVKFIPRRDREQE---KATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .|::||.|.:|..|::||.|   ||..|.|:|:||..||..::.|:|:|..:|:..|.|:|.|..
Human   163 LNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPN 227

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            |:|:.||||:||..:.|..||..::||:: ..|.::|.||..|.|||.|:.||.|:.|:::
Human   228 GKSKGFGFVSYEKHEDANKAVEEMNGKEI-SGKIIFVGRAQKKVERQAELKRKFEQLKQER 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 46/69 (67%)
RRM3_I_PABPs 202..282 CDD:240826 32/79 (41%)
PABPC4NP_001129125.1 PABP-1234 11..640 CDD:130689 96/191 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.