DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PAB1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_011092.1 Gene:PAB1 / 856912 SGDID:S000000967 Length:577 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:87/192 - (45%)
Similarity:127/192 - (66%) Gaps:4/192 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGM 176
            ||.|:||||...|||||:||||||||:||:..:|.||:|.|:|:|||||:.|.||:.||:.:|||
Yeast   125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGM 189

  Fly   177 LCNNQKVHVVKFIPRRDRE---QEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE 238
            |.|.|:::|...:.|::|:   :|...|:.||||||::.|.|::..:|:|..:|.|.|..|..|.
Yeast   190 LLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDA 254

  Fly   239 EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK 300
            :|:.:.||||.||..:.|:.||..|:..:|...| |||.||..|.||...:.::.|..:.:|
Yeast   255 DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEK-LYVGRAQKKNERMHVLKKQYEAYRLEK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 42/69 (61%)
RRM3_I_PABPs 202..282 CDD:240826 33/79 (42%)
PAB1NP_011092.1 PABP-1234 38..559 CDD:130689 87/192 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343873
Domainoid 1 1.000 101 1.000 Domainoid score I1542
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.