DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and MIP6

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_011879.1 Gene:MIP6 / 856408 SGDID:S000001057 Length:659 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:42/205 - (20%)
Similarity:82/205 - (40%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNL---ERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNG- 175
            ::..||   ...:..::.|.....:||:|:|.:.:     .:..|||:||::.:||..|:|.|. 
Yeast   201 VFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLER-----RKNIGFVYFDNDISARNVIKKYNNQ 260

  Fly   176 ------MLCNNQKVHVVKFIPRRDREQEKA----------------------THFKNLYVKNLSE 212
                  ::|.   :|..|.:..|....::.                      ...|.:.||||..
Yeast   261 EFFGNKIICG---LHFDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPS 322

  Fly   213 EFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVA 277
            :.|::.:.:.|...|.|.| ..:.:::..:....||.|:|.:.:..|...|: |.:..|..::|.
Yeast   323 DTTQEEVLDYFSTIGPIKS-VFISEKQANTPHKAFVTYKNEEESKKAQKCLN-KTIFKNHTIWVG 385

  Fly   278 RALSKAERQQ 287
            ....|....|
Yeast   386 PGKDKPVHNQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/79 (23%)
RRM3_I_PABPs 202..282 CDD:240826 19/79 (24%)
MIP6NP_011879.1 RRM 8..>187 CDD:223796
RRM1_PES4_MIP6 111..190 CDD:410180
RRM2_PES4_MIP6 200..275 CDD:410181 19/81 (23%)
RRM3_PES4_MIP6 313..385 CDD:410182 18/73 (25%)
RRM4_PES4_MIP6 400..478 CDD:410183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.