Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011879.1 | Gene: | MIP6 / 856408 | SGDID: | S000001057 | Length: | 659 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 205 | Identity: | 42/205 - (20%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 42/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 IYIKNL---ERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNG- 175
Fly 176 ------MLCNNQKVHVVKFIPRRDREQEKA----------------------THFKNLYVKNLSE 212
Fly 213 EFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVA 277
Fly 278 RALSKAERQQ 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 18/79 (23%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 19/79 (24%) | ||
MIP6 | NP_011879.1 | RRM | 8..>187 | CDD:223796 | |
RRM1_PES4_MIP6 | 111..190 | CDD:410180 | |||
RRM2_PES4_MIP6 | 200..275 | CDD:410181 | 19/81 (23%) | ||
RRM3_PES4_MIP6 | 313..385 | CDD:410182 | 18/73 (25%) | ||
RRM4_PES4_MIP6 | 400..478 | CDD:410183 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24012 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |