DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and RIM4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_011839.1 Gene:RIM4 / 856361 SGDID:S000001016 Length:713 Species:Saccharomyces cerevisiae


Alignment Length:177 Identity:42/177 - (23%)
Similarity:76/177 - (42%) Gaps:39/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NSLGSGHTS----TSSHSANV-----------GVGVGGGALASGSTGGSGGNSSPDSGKIYIKNL 120
            :||||.|.:    :.:.|.|.           ..|.|.....|.||...|..||    .|::.:|
Yeast    40 SSLGSDHQNDGEDSDTDSDNFLQDPEDDVDEESTGRGTVTTTSTSTESRGRPSS----CIFVASL 100

  Fly   121 ERSIDNK----AVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQ 181
            ..::.:.    :|.:.|..:|::....|.:  |..:|.|.||.::::..|:.|:.:..|.|.|.:
Yeast   101 AAALSDDELCLSVTENFKKYGDLARVKVLR--DNANRPYAFVQYNNDHDAKHALIRAQGTLLNGR 163

  Fly   182 KVHVVKFIPRRDREQEKATHFKNLYVKN-LSEEFTEQHLREMFEPYG 227
            ::..           |.|...:.||:|| .|.:|.|  :.::.|.:|
Yeast   164 RLRC-----------EPAKVNRTLYLKNQQSIDFNE--ISQICEKFG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/73 (22%)
RRM3_I_PABPs 202..282 CDD:240826 9/27 (33%)
RIM4NP_011839.1 RRM 1..>191 CDD:223796 40/169 (24%)
RRM1_RIM4_like 91..176 CDD:409887 20/101 (20%)
RRM_SF 176..242 CDD:409669 9/24 (38%)
SF-CC1 300..>378 CDD:273721
RRM2_RIM4_like 343..420 CDD:409888
YppG 615..>669 CDD:372950
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.