DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PRP24

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_013995.1 Gene:PRP24 / 855310 SGDID:S000004881 Length:444 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:61/302 - (20%)
Similarity:105/302 - (34%) Gaps:104/302 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GGALASGSTGGSGGNS---SPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD------- 147
            |...|:|.|......:   :.:...:.:|||.:|.:...||..|...|.|::.:||..       
Yeast    18 GSPAAAGLTSKKANEALTRNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKNFRF 82

  Fly   148 -------EDG------------------------------------------------------- 150
                   .||                                                       
Yeast    83 ARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYTQRNIRDLLQDINVVALSI 147

  Fly   151 --------NSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHF----- 202
                    .||.:.::...|:|.||..:||:||:     |:.....:.:.....||:...     
Yeast   148 RLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGL-----KIEGYTLVTKVSNPLEKSKRTDSATL 207

  Fly   203 --KNLYVKNLSEEFTEQH-LREMFEPYGRITSHKLMLDEEGRSRRF----GFVAYENPQSALAAV 260
              :.:.::|||.|..::: |||.||.:|.|  .|:.:....:...|    .|:.:||..||..| 
Yeast   208 EGREIMIRNLSTELLDENLLRESFEGFGSI--EKINIPAGQKEHSFNNCCAFMVFENKDSAERA- 269

  Fly   261 IGLHGKQLGDNKFLYVARALSK--AERQQEINRKLEERKRQK 300
            :.::...|| |:.:.|:.|..|  .|| .|:.|.|..|..::
Yeast   270 LQMNRSLLG-NREISVSLADKKPFLER-NEVKRLLASRNSKE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 24/146 (16%)
RRM3_I_PABPs 202..282 CDD:240826 24/91 (26%)
PRP24NP_013995.1 RRM1_Prp24 41..113 CDD:409737 13/71 (18%)
RRM2_Prp24 117..195 CDD:409738 11/82 (13%)
RRM3_Prp24 210..286 CDD:409739 23/79 (29%)
RRM4_Prp24 312..386 CDD:409740
Lsm_interact 425..443 CDD:398843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861654 Normalized mean entropy S4474
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.