DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and ZCRB1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens


Alignment Length:215 Identity:38/215 - (17%)
Similarity:71/215 - (33%) Gaps:94/215 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGFVHFDSEEAARAA 169
            |..:|....:|:.||..|:.|..:|..||.:|.::...:.||:| ..|:|..|:.|..:::|:..
Human     3 GGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNC 67

  Fly   170 IEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKL 234
            ...:|.                                |.|               :||:....:
Human    68 TRAINN--------------------------------KQL---------------FGRVIKASI 85

  Fly   235 MLDEEGRSRRF------------------GFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALS 281
            .:| .||:..|                  |.::|..|::.|.                       
Human    86 AID-NGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLG----------------------- 126

  Fly   282 KAERQQEINRKLEERKRQKA 301
                ::|..:|.|::|::||
Human   127 ----EREPPKKKEKKKKKKA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/70 (26%)
RRM3_I_PABPs 202..282 CDD:240826 12/97 (12%)
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 22/123 (18%)
AIR1 <97..123 CDD:331526 3/25 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 8/50 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.