DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and HRP1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_014518.1 Gene:HRP1 / 853997 SGDID:S000005483 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:319 Identity:68/319 - (21%)
Similarity:119/319 - (37%) Gaps:91/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGGHAASNHLAAAAVLGR--------HGHNSLGSGHTSTSSHSANVGV----------------- 89
            |.|.:..:.|||...|..        :.:||..:.....:|.|...|.                 
Yeast    33 GSGTSQLDQLAALQALSSSLNKLNNPNSNNSSSNNSNQDTSSSKQDGTANDKEGSNEDTKNEKKQ 97

  Fly    90 --GVGGGALASGSTGGSGG-----------------NSSP-------------------DSGKIY 116
              .....|.|:.|:.|..|                 :.||                   :|.|::
Yeast    98 ESATSANANANASSAGPSGLPWEQLQQTMSQFQQPSSQSPPQQQVTQTKEERSKADLSKESCKMF 162

  Fly   117 I--KNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            |  .|.:.:.||...|  |..:|.:.:..:.|| ..|.|||:||:.|:...:....::..:  :.
Yeast   163 IGGLNWDTTEDNLREY--FGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQH--IL 223

  Fly   179 NNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRS 242
            :.:.:...:.|||  .||:|.   ..::|..:..:...:...|.|..:|.|...:||||:: |:|
Yeast   224 DGKVIDPKRAIPR--DEQDKT---GKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQS 283

  Fly   243 RRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKA 301
            |.||||.|::..:.         .::..|||      :...:|:.||.|......:||:
Yeast   284 RGFGFVTYDSADAV---------DRVCQNKF------IDFKDRKIEIKRAEPRHMQQKS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/72 (22%)
RRM3_I_PABPs 202..282 CDD:240826 20/80 (25%)
HRP1NP_014518.1 PABP-1234 <144..463 CDD:130689 50/208 (24%)
RRM1_Hrp1p 161..236 CDD:409991 17/78 (22%)
RRM2_Hrp1p 244..321 CDD:409767 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.