DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and NSR1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_011675.1 Gene:NSR1 / 853064 SGDID:S000003391 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:40/168 - (23%)
Similarity:79/168 - (47%) Gaps:11/168 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            |::..|..|||::.:...|...|.::...|..:. ...|||||:|.|:::..|..||:::.|...
Yeast   170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEI 234

  Fly   179 NNQKVHVVKFIPRRDREQEKATHF--------KNLYVKNLSEEFTEQHLREMFEPYGRITSHKLM 235
            :.:.::......:.....::|..|        ..|::.|||.......:.|:|..:|.:.|.::.
Yeast   235 DGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIP 299

  Fly   236 L-DEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNK 272
            . .|..:.:.||:|.:.|.:.|..|:..|.|:.: ||:
Yeast   300 THPETEQPKGFGYVQFSNMEDAKKALDALQGEYI-DNR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/70 (27%)
RRM3_I_PABPs 202..282 CDD:240826 20/80 (25%)
NSR1NP_011675.1 RRM1_gar2 169..244 CDD:409881 19/73 (26%)
RRM2_gar2 269..341 CDD:409882 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.