DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and RNP1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_013054.1 Gene:RNP1 / 850680 SGDID:S000003969 Length:249 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:35/132 - (26%)
Similarity:69/132 - (52%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 IEKVNGMLCNNQKVHVVKFIPRRDREQEKATH-FKNLYVKNLSEEFTEQHLREMFEP-YGRITSH 232
            ||::.....|.:|...|  :|...:.:::..: .:.|||.||.:...:|.||::||| ||:||.:
Yeast     3 IEEIEFYNVNGKKTTTV--VPENTKIKKRVLNDRRTLYVGNLPKNCRKQDLRDLFEPNYGKITIN 65

  Fly   233 KLMLDEEGRS---RRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLE 294
              ||.::...   :||.|:.::...:.......::|| :..|:.:.:...|:|.|:..|.|:|..
Yeast    66 --MLKKKPLKKPLKRFAFIEFQEGVNLKKVKEKMNGK-IFMNEKIVIENILTKEEKSFEKNQKSN 127

  Fly   295 ER 296
            ::
Yeast   128 KK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 4/14 (29%)
RRM3_I_PABPs 202..282 CDD:240826 24/83 (29%)
RNP1NP_013054.1 RRM <22..224 CDD:223796 29/111 (26%)
RRM 36..109 CDD:214636 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.