DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PES4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_116678.1 Gene:PES4 / 850579 SGDID:S000001919 Length:611 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:60/235 - (25%)
Similarity:92/235 - (39%) Gaps:63/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERS---IDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNG- 175
            ::..||..:   :..:..|||||.:|.||:|.:...:|     .|||:|:.|:.||..|:..|. 
Yeast   181 VFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKLDSRKD-----IGFVYFEDEKTARNVIKMYNNT 240

  Fly   176 ------MLCNNQKVHVVKFIP-------RRDRE---------QEKAT-----HFKNLY------- 206
                  :||.......|:.:|       |.|.|         .||.:     ..||:|       
Yeast   241 SFFGKKILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSI 305

  Fly   207 -VKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSR-RFGFVAYENPQSALAAVIGLHGKQLG 269
             :|||....|...:...|...|.|.|  :.|....:.: .:.||.|:|...:..|:     |:..
Yeast   306 FIKNLPTITTRDDILNFFSEVGPIKS--IYLSNATKVKYLWAFVTYKNSSDSEKAI-----KRYN 363

  Fly   270 D----NKFLYVARALSKAERQQEINRKLEERKRQKAGQIF 305
            :    .|.|.|.||..|.||.:.|       :.||...:|
Yeast   364 NFYFRGKKLLVTRAQDKEERAKFI-------ESQKISTLF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/79 (29%)
RRM3_I_PABPs 202..282 CDD:240826 23/92 (25%)
PES4NP_116678.1 PABP-1234 93..>461 CDD:130689 60/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.