DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CSTF64

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:124 Identity:32/124 - (25%)
Similarity:57/124 - (45%) Gaps:30/124 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVIGL----- 263
            ::|.|:..:.||:.|||:....|.:.|.:|:.|.| |:.:.:||..|::.::||:|...|     
plant    11 VFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNLQSYEI 75

  Fly   264 HGKQL---------GDNKFLYVARALSK-----------AERQQEINRKLEERKRQKAG 302
            :|:||         |.:|    .|..|:           .|.|::|...::....|..|
plant    76 NGRQLRVDFAENDKGTDK----TRDQSQGGPGLPSTTTVTESQKQIGGPVDSNMHQPVG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825
RRM3_I_PABPs 202..282 CDD:240826 26/91 (29%)
CSTF64NP_177325.2 PABP-1234 <11..318 CDD:130689 32/124 (26%)
RRM_CSTF2_CSTF2T 11..85 CDD:241115 23/73 (32%)
CSTF2_hinge 160..228 CDD:373015
PAT1 <222..>433 CDD:370676
CSTF_C 419..454 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.