DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PAB5

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001185373.1 Gene:PAB5 / 843507 AraportID:AT1G71770 Length:682 Species:Arabidopsis thaliana


Alignment Length:199 Identity:94/199 - (47%)
Similarity:134/199 - (67%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDS-----GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAA 166
            |..|.:     |.::||||:.||||||:|:|||.||.||:|.||.|..|.|:|||||.|:.||.|
plant   135 NRDPSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETA 199

  Fly   167 RAAIEKVNGMLCNNQKVHVVKFIPRRDR---EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGR 228
            :|||:|:||||.|:::|.|..|:.|:||   |......|.|:|||||.:|.|:..|::.|..||.
plant   200 QAAIDKLNGMLLNDKQVFVGHFVRRQDRARSESGAVPSFTNVYVKNLPKEITDDELKKTFGKYGD 264

  Fly   229 ITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKL 293
            |:|..:|.|:.|.||.||||.:.:|::|..||..::|..||:: .|||.||..|::|::|:.||.
plant   265 ISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGED-VLYVGRAQKKSDREEELRRKF 328

  Fly   294 EERK 297
            |:.:
plant   329 EQER 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 43/69 (62%)
RRM3_I_PABPs 202..282 CDD:240826 36/79 (46%)
PAB5NP_001185373.1 PABP-1234 59..661 CDD:130689 94/199 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2252
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.