DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PAB8

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001185184.1 Gene:PAB8 / 841399 AraportID:AT1G49760 Length:671 Species:Arabidopsis thaliana


Alignment Length:323 Identity:115/323 - (35%)
Similarity:165/323 - (51%) Gaps:50/323 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGSGH---TSTSSH----- 83
            :|...||.|..:...|....:......||:...||||...:.|..||..|.   |.|.|.     
plant     1 MAQIQHQGQNANGGVAVPGAAAAEAAAAAAGAAAAAAGAAQQGTTSLYVGDLDATVTDSQLFEAF 65

  Fly    84 ---SANVGVGVGGGALASGSTG-GSGGNSSPDS-------------------------------- 112
               ...|.|.|........|.| |....::|..                                
plant    66 TQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVRDPSLRKS 130

  Fly   113 --GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNG 175
              |.|:||||::|||:||:::|||.||.||:|.||.|..|.|:|||||.:|::|||:.||:|:||
plant   131 GVGNIFIKNLDKSIDHKALHETFSAFGPILSCKVAVDPSGQSKGYGFVQYDTDEAAQGAIDKLNG 195

  Fly   176 MLCNNQKVHVVKFIPR--RDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE 238
            ||.|:::|:|..|:.:  ||...|| ..|.|:|||||||..:::.|.::|..:|..||..:|.|.
plant   196 MLLNDKQVYVGPFVHKLQRDPSGEK-VKFTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDG 259

  Fly   239 EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKA 301
            ||:|:.||||.:||...|..||..|:||.. |:|..:|.:|..|:||:.|:.:|.|:..::.|
plant   260 EGKSKGFGFVNFENSDDAARAVDALNGKTF-DDKEWFVGKAQKKSERETELKQKFEQSLKEAA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 41/69 (59%)
RRM3_I_PABPs 202..282 CDD:240826 35/79 (44%)
PAB8NP_001185184.1 PABP-1234 46..646 CDD:130689 103/278 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2252
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.